Structure of PDB 6k80 Chain A

Receptor sequence

>6k80A (length=213) Species: 7227 (Drosophila melanogaster)

SHMPYTIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKELEKYSLK
PLPDNCSYKAVNKKGEIIGVFLNGLMRRPSPDDVPEKAADSCEHPKFKKI
LSLMDHVEEQFNIFDVYPDEELILDGKILSVDTNYRGLGIAGRLTERAYE
YMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQFADYKPQGEVVFKPA
APHVGIQVMAKEV

3D structure

• PDB: 6k80 An essential role of acetyl coenzyme A in the catalytic cycle of insect arylalkylamine N-acetyltransferase.
• Chain: A
• Resolution: 1.28 Å

Enzymatic activity

• Enzyme Commision number: 2.3.1.87: aralkylamine N-acetyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZCW	A	H184 R200 M201 V221 G222 I223 Q224	H167 R183 M184 V204 G205 I206 Q207
BS02	ZCW	A	F43 E47 N50 L61 F114 I117 M121 I145 L180	F26 E30 N33 L44 F97 I100 M104 I128 L163
BS03	ACO	A	D46 K144 I145 L146 V148 R153 G154 G156 A158 L180 K192	D29 K127 I128 L129 V131 R136 G137 G139 A141 L163 K175

Gene Ontology

Molecular Function

• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

External links

• PDB: RCSB:6k80, PDBe:6k80, PDBj:6k80
• PDBsum: 6k80
• PubMed: 32796911
• UniProt: Q94521|DNAT_DROME Arylalkylamine N-acetyltransferase 1 (Gene Name=speck)