Structure of PDB 6jus Chain A

Receptor sequence

>6jusA (length=347) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

MTKWVLHVDLDQFLASVELRRRPDLRGQPVIVGGSGDPSEPRKVVTCASY
EAREFGVHAGMPLRAAARRCPDATFLPSDPAAYDEASEQVMGLLRDLGHP
LEVWGWDEAYLGADLPDESDPVEVAERIRTVVAAETGLSCSVGISDNKQR
AKVATGFAKPAGIYVLTEANWMTVMGDRPPDALWGVGPKTTKKLAAMGIT
TVADLAVTDPSVLTTAFGPSTGLWLLLLAKGGGDTEVSSEPWVPRSRSHV
VTFPQDLTERREMDSAVRDLALQTLAEIVEQGRIVTRVAVTVRTSTFYTR
TKIRKLPAPSTDAGQIVDTALAVLDQFELDRPVRLLGVRLELAMDDV

3D structure

• PDB: 6jus A polar filter in DNA polymerases prevents ribonucleotide incorporation.
• Chain: A
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	R42 V44 R64 A65 R68 W242 P244 R245 S246 R247 S248 H249 V250 T252 F297 R334	R42 V44 R64 A65 R68 W242 P244 R245 S246 R247 S248 H249 V250 T252 F297 R334
BS02	dna	A	E108 K152 W184 G185 G187 K189 T190 R287 I303 K305	E108 K152 W184 G185 G187 K189 T190 R287 I303 K305
BS03	dna	A	K193 A196	K193 A196
BS04	2TM	A	D9 D11 Q12 L14 T46 Y50 R53 D107 K159	D9 D11 Q12 L14 T46 Y50 R53 D107 K159
BS05	MN	A	D9 D107 E108	D9 D107 E108
BS06	MN	A	D9 L10 D107	D9 L10 D107

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0003677 DNA binding
• GO:0003684 damaged DNA binding
• GO:0003887 DNA-directed DNA polymerase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006261 DNA-templated DNA replication
• GO:0006281 DNA repair
• GO:0006974 DNA damage response
• GO:0009432 SOS response
• GO:0042276 error-prone translesion synthesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6jus, PDBe:6jus, PDBj:6jus
• PDBsum: 6jus
• PubMed: 31544946
• UniProt: A0QR77