Structure of PDB 6jrf Chain A

Receptor sequence

>6jrfA (length=163) Species: 4577 (Zea mays) [Search protein sequence]

GWVIGVDPDIGGAIAVLSPDGSSQVFDNPFVHIVVSEVIRKRLDTKSIIQ
LLRGLDAPPGTTAYIEKSSPFPTDGKQGWWSTGFSYGLWIASLVASGFSV
VPIASQTWKAYFGLMRSETPKDDSRQAASILFPDKDQSLKLKKHHGRAEA
LLLAAYGKGLVLP

3D structure

PDB

6jrf Structural basis of sequence-specific Holliday junction cleavage by MOC1.

Chain

Resolution

2.047 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	V143 S144 R148 T181 D182 G183 K184 Q185 G186 L249 K250 K251	V35 S36 R40 T73 D74 G75 K76 Q77 G78 L141 K142 K143
BS02	dna	A	D117 I118 R148 K175 S177 F179 P180 D182 G186 W187 S189 S213 Q214 T215 K217 M223 R224 K229	D9 I10 R40 K67 S69 F71 P72 D74 G78 W79 S81 S105 Q106 T107 K109 M115 R116 K121
BS03	CA	A	D115 D117 E257	D7 D9 E149
BS04	CA	A	D115 E174	D7 E66

Gene Ontology

	Molecular Function
GO:0008821	crossover junction DNA endonuclease activity

View graph for
Molecular Function

External links

PDB	RCSB:6jrf, PDBe:6jrf, PDBj:6jrf
PDBsum	6jrf
PubMed	31611704
UniProt	B4FCI7

[Back to BioLiP]