Structure of PDB 6jnl Chain A

Receptor sequence

>6jnlA (length=89) Species: 3702 (Arabidopsis thaliana)

RNICPIKGCGKNFFSHKYLVQHQRVHSDDRPLKCPWKGCKMTFKWAWSRT
EHIRVHTGARPYVCAEPDCGQTFRFVSDFSRHKRKTGHS

3D structure

• PDB: 6jnl DNA methylation repels targeting of Arabidopsis REF6.
• Chain: A
• Resolution: 2.15 Å

Enzymatic activity

• Enzyme Commision number: 1.14.11.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	F1277 F1278 Y1282 H1286 V1289 W1309 S1312 H1316 R1338 F1339 D1342	F13 F14 Y18 H22 V25 W45 S48 H52 R74 F75 D78	PDBbind-CN: Kd=73.5nM
BS02	dna	A	W1311 Y1326 V1340 S1341 S1344 R1348	W47 Y62 V76 S77 S80 R84	PDBbind-CN: Kd=73.5nM
BS03	ZN	A	C1268 C1273 H1286 H1290	C4 C9 H22 H26
BS04	ZN	A	C1328 C1333 H1346 H1352	C64 C69 H82 H88
BS05	ZN	A	C1298 C1303 H1316 H1320	C34 C39 H52 H56
BS06	MG	A	C1298 W1300 C1303	C34 W36 C39

External links

• PDB: RCSB:6jnl, PDBe:6jnl, PDBj:6jnl
• PDBsum: 6jnl
• PubMed: 31048693
• UniProt: Q9STM3|REF6_ARATH Lysine-specific demethylase REF6 (Gene Name=REF6)