Structure of PDB 6jmq Chain A

Receptor sequence

>6jmqA (length=403) Species: 9606 (Homo sapiens) [Search protein sequence]

ITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVG
ALCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVA
LVFATYLLKPLFPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDA
FAAAKLLALALIILLGFVQIFSFEGTKLDVGNIVLALYSGLFAYGGWNYL
NFVTEEMINPYRNLPLAIIISLPIVTLVYVLTNLAYFTTLSTEQMLSSEA
VAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVLLTPVPSL
VFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELER
PIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVW
WKN

3D structure

PDB

6jmq Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.

Chain

Resolution

3.31 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	A	L156 P159 V329 L333 F336	L107 P110 V269 L273 F276
BS02	CLR	A	L386 F389 I460	L309 F312 I383

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0015171	amino acid transmembrane transporter activity
GO:0015173	aromatic amino acid transmembrane transporter activity
GO:0015175	neutral L-amino acid transmembrane transporter activity
GO:0015179	L-amino acid transmembrane transporter activity
GO:0015190	L-leucine transmembrane transporter activity
GO:0015196	L-tryptophan transmembrane transporter activity
GO:0015297	antiporter activity
GO:0015349	thyroid hormone transmembrane transporter activity
GO:0022857	transmembrane transporter activity
GO:0042605	peptide antigen binding

	Biological Process
GO:0002720	positive regulation of cytokine production involved in immune response
GO:0003333	amino acid transmembrane transport
GO:0006865	amino acid transport
GO:0010507	negative regulation of autophagy
GO:0010629	negative regulation of gene expression
GO:0014850	response to muscle activity
GO:0015804	neutral amino acid transport
GO:0015807	L-amino acid transport
GO:0015818	isoleucine transport
GO:0015820	L-leucine transport
GO:0015821	methionine transport
GO:0015823	phenylalanine transport
GO:0015824	proline transport
GO:0015827	tryptophan transport
GO:0015828	tyrosine transport
GO:0015829	valine transport
GO:0032328	alanine transport
GO:0032729	positive regulation of type II interferon production
GO:0032740	positive regulation of interleukin-17 production
GO:0032753	positive regulation of interleukin-4 production
GO:0042149	cellular response to glucose starvation
GO:0042908	xenobiotic transport
GO:0055085	transmembrane transport
GO:0055093	response to hyperoxia
GO:0060252	positive regulation of glial cell proliferation
GO:0070327	thyroid hormone transport
GO:0071222	cellular response to lipopolysaccharide
GO:0071230	cellular response to amino acid stimulus
GO:0089718	amino acid import across plasma membrane
GO:0097421	liver regeneration
GO:0150104	transport across blood-brain barrier
GO:1902024	L-histidine transport
GO:1902475	L-alpha-amino acid transmembrane transport
GO:1903577	cellular response to L-arginine
GO:1903801	L-leucine import across plasma membrane
GO:1904556	L-tryptophan transmembrane transport
GO:1905460	negative regulation of vascular associated smooth muscle cell apoptotic process
GO:1905534	positive regulation of L-leucine import across plasma membrane

	Cellular Component
GO:0005764	lysosome
GO:0005765	lysosomal membrane
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0009925	basal plasma membrane
GO:0016020	membrane
GO:0016323	basolateral plasma membrane
GO:0016324	apical plasma membrane
GO:0031528	microvillus membrane
GO:0043231	intracellular membrane-bounded organelle
GO:0070062	extracellular exosome
GO:0098591	external side of apical plasma membrane
GO:1990184	amino acid transport complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6jmq, PDBe:6jmq, PDBj:6jmq
PDBsum	6jmq
PubMed	31160781
UniProt	Q01650\|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 (Gene Name=SLC7A5)

[Back to BioLiP]