Structure of PDB 6jlu Chain A

Receptor sequence

>6jluA (length=334)

VSLWERFCAWITSTENRLYIGWFGCLMFPTLLTATSCFIIAFIAAPPVDI
DGIREPVSGSLLYGNNIISGAVVPSSNAIGMHFYPIWEAASVDEWLYNGG
PYQLIVLHFLLGVSAYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV
YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSL
FSAMHGSLVTSSLIRETTENESTNYGYKFGQEEETYNIVAAHGYFGRLIF
QYASFNNSRALHFFLALWPVVGIWITAMGISTMAFNLNGFNFNQSVVDSQ
GRVINTWADILNRANLGIEVMHERNAHNFPLDLA

3D structure

• PDB: 6jlu The pigment-protein network of a diatom photosystem II-light-harvesting antenna supercomplex.
• Chain: A
• Resolution: 3.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	OEX	A	D170 E189 H332 E333 H337 D342 A344	D160 E179 H322 E323 H327 D332 A334
BS02	FE2	A	H215 H272	H205 H262
BS03	CLA	A	F119 F147 P150 A153 V157 M183 Q187 L193 H198 G201 V202 F206 I290	F109 F137 P140 A143 V147 M173 Q177 L183 H188 G191 V192 F196 I280
BS04	CLA	A	V202 F206 L210	V192 F196 L200
BS05	PHO	A	T45 Y126 E130 A146 F147 P150 L174 P279 I283	T35 Y116 E120 A136 F137 P140 L164 P269 I273
BS06	CLA	A	L36 P39 T40 F93 P95 I96 W97 L114 H118 L121	L26 P29 T30 F83 P85 I86 W87 L104 H108 L111
BS07	CLA	A	S124 W131	S114 W121
BS08	CLA	A	F119 M172 I176 F180 M183	F109 M162 I166 F170 M173
BS09	PHO	A	F206 S209 L210 M214	F196 S199 L200 M204

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 29 04:35:05 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6jlu', asym_id = 'A', title = 'The pigment-protein network of a diatom photosystem II-light-harvesting antenna supercomplex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6jlu', asym_id='A', title='The pigment-protein network of a diatom photosystem II-light-harvesting antenna supercomplex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009055,0009772,0019684,0045156', uniprot = '', pdbid = '6jlu', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009055,0009772,0019684,0045156', uniprot='', pdbid='6jlu', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>