Structure of PDB 6jl2 Chain A

Receptor sequence

>6jl2A (length=401) Species: 672 (Vibrio vulnificus)

ALSPEAITSAQVFSTQSKETYTYVRCWYRTGNSHDESATDWEWAENPDGS
YFTIDGYWWSSVRLKNMFYTNTSQNVIKQRCEETLGVTHDAADITYFAAD
NRWSYNHTIWTNDPVMQADQINKIVAFGDSLSDTGNIFNAAQWRFPNPDT
WFLGHFSNGFVWTEYIAQAKKLPLYNWAVGGAAGSNQYVALTGVKDQVLS
YLTYAKMAKNYKPENTLFTLEFGLNDFMNYNREVVDVKTDFSTALIKLTD
AGAKNIMLMTLPDATKAPQFKYSTQAEIEKVRAKIVEFNEFIKAQAAFYI
IQGYNITLYDTHGLFEQLTQNPQQHGFVNASDACLNINRASSADYLYSHS
LTNECATHSSDKYVFWNVTHPTTAVHKYIAEKMLAPGAGMQRFNFHHHHH
H

3D structure

• PDB: 6jl2 Structural analysis of aVibriophospholipase reveals an unusual Ser-His-chloride catalytic triad.
• Chain: A
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1PS	A	K87 N158 N198 W199 A212 L213 Y226	K65 N136 N176 W177 A190 L191 Y204
BS02	1PS	A	R124 W125 S126 Y127 W165	R102 W103 S104 Y105 W143
BS03	1PS	A	W80 R85 D122 S126 Y127 H129	W58 R63 D100 S104 Y105 H107

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 30 05:21:04 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6jl2', asym_id = 'A', title = 'Structural analysis of aVibriophospholipase reveals an unusual Ser-His-chloride catalytic triad.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6jl2', asym_id='A', title='Structural analysis of aVibriophospholipase reveals an unusual Ser-His-chloride catalytic triad.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0006629,0016298,0016788', uniprot = '', pdbid = '6jl2', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006629,0016298,0016788', uniprot='', pdbid='6jl2', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>