Structure of PDB 6jks Chain A

Receptor sequence

>6jksA (length=321) Species: 353153 (Trypanosoma cruzi strain CL Brener)

ELPPVASLKGKSITSAEQFSRADIYALIHLASAMQRKIDAGEVLNLLQGR
IMTPLFFEDSSRTFSSFCAAMIRLGGSVVNFKVEASSINKGETLADTIRT
LDSYSDVLVMRHPRQDAIEEALSVAQHPILNAGNGAGEHPTQALLDTLTI
HSELGSVDGITIALIGDLKMGRTVHSLLKLLVRNFSIKCVFLVAPDALQM
PQDVLEPLQHEIATKGVIIHRTHALTDEVMQKSDVLYTTRLQKERFTSDD
AAALQSFAAKADITIDAARMRLAKEKMIVMHPLPRNDELSTTVDADPRAA
YFRQMRYGMFMRMAILWSVLA

3D structure

• PDB: 6jks Crystallographic snapshots of Trypanosoma cruzi aspartate transcarbamoylase revealed an ordered Bi-Bi reaction mechanism
• Chain: A
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R113 H141 Q144 T241 P287 G313
• Catalytic site (residue number reindexed from 1): R111 H139 Q142 T239 P282 G308
• Enzyme Commision number: 2.1.3.2: aspartate carbamoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CP	A	S62 S63 R64 T65 R113 H141 P287 L288	S60 S61 R62 T63 R111 H139 P282 L283
BS02	ASP	A	R113 R174 R242 Q244 L288	R111 R172 R240 Q242 L283

Gene Ontology

Molecular Function

• GO:0004070 aspartate carbamoyltransferase activity
• GO:0016597 amino acid binding
• GO:0016740 transferase activity
• GO:0016743 carboxyl- or carbamoyltransferase activity

Biological Process

• GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process
• GO:0006221 pyrimidine nucleotide biosynthetic process
• GO:0006520 amino acid metabolic process
• GO:0044205 'de novo' UMP biosynthetic process

External links

• PDB: RCSB:6jks, PDBe:6jks, PDBj:6jks
• PDBsum: 6jks
• UniProt: Q4D3W3