Structure of PDB 6ji2 Chain A

Receptor sequence

>6ji2A (length=432) Species: 272557 (Aeropyrum pernix K1)

KPHMNLVVIGHVDHGKSTLVGHLLYRLGYIEEKKLKELEEQAKSRGKESF
KFAWILDKMKEERERGITIDLTFMKFETKKYVFTIIDAPGHRDFVKNMIT
GASQADAAILVVSARKGEFEAGMSTEGQTREHLLLARTMGIEQIIVAVNK
MDAPDVNYDQKRYEFVVSVLKKFMKGLGYQVDKIPFIPVSAWKGDNLIER
SPNMPWYNGPTLVEALDQLQPPAKPVDKPLRIPVQNVYSIPGAGTVPVGR
VETGVLRVGDKVVFMPPGVVGEVRSIEMHYQQLQQAEPGDNIGFAVRGVS
KSDIKRGDVAGHLDKPPTVAEEFEARIFVIWHPSAITVGYTPVIHVHTAS
VSSRIIEIKAKLDPKTGQVVEQNPQFLKAGDAAIVRFKPVKPLVVEKFSE
IPQLGRFAMRDMNRTVGIGIVTDVKPAKVDIK

3D structure

• PDB: 6ji2 Switch of the interactions between the ribosomal stalk and EF1A in the GTP- and GDP-bound conformations.
• Chain: A
• Resolution: 3.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D16 K19 S20 T71 H94
• Catalytic site (residue number reindexed from 1): D13 K16 S17 T68 H91

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	R140 G179 L180 F401 R409 I423	R137 G176 L177 F398 R406 I420
BS02	GTP	A	V15 D16 G18 K19 S20 T21 S52 F53 I70 T71 G93 N152 K153 D155 S193 A194 W195	V12 D13 G15 K16 S17 T18 S49 F50 I67 T68 G90 N149 K150 D152 S190 A191 W192
BS03	MG	A	S20 T71 D90	S17 T68 D87

Gene Ontology

Molecular Function

• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6ji2, PDBe:6ji2, PDBj:6ji2
• PDBsum: 6ji2
• PubMed: 31611569
• UniProt: Q9YAV0|EF1A_AERPE Elongation factor 1-alpha (Gene Name=tuf)