Structure of PDB 6jf7 Chain A

Receptor sequence
>6jf7A (length=151) Species: 470 (Acinetobacter baumannii) [Search protein sequence]
VVLPVAKRGEDILKLIAAPVSANELNSNWLYQLADAMHATMLERNGVGIA
APQVYISKRVIIVASRPNAPEMNAVVMVNPEILEFSSEMCLGEEGCLSVP
ERGQVERAEMVKVKYLTLQGEMVETVFQGFPARIVQHEVDHLNGILFVER
I
3D structure
PDB6jf7 K3U bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii
ChainA
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A C103 H145 H149 C96 H137 H141
BS02 K3U A N47 G48 V49 G50 Q55 E101 G102 C103 L104 F138 H145 E146 N45 G46 V47 G48 Q53 E94 G95 C96 L97 F130 H137 E138
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 06:23:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6jf7', asym_id = 'A', title = 'K3U bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6jf7', asym_id='A', title='K3U bound crystal structure of class I type b peptide deformylase from Acinetobacter baumannii')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0042586', uniprot = '', pdbid = '6jf7', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0042586', uniprot='', pdbid='6jf7', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>