Structure of PDB 6j99 Chain A

Receptor sequence
>6j99A (length=97) Species: 8355 (Xenopus laevis) [Search protein sequence]
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSS
AVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
3D structure
PDB6j99 Structural basis of the crosstalk between histone H2B monoubiquitination and H3 lysine 79 methylation on nucleosome.
ChainA
Resolution4.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A H39 Y41 R42 T45 R63 R72 R83 F84 Q85 R116 V117 T118 M120 H2 Y4 R5 T8 R26 R35 R46 F47 Q48 R79 V80 T81 M83
BS02 dna A R40 Y41 R42 P43 R49 R63 K64 L65 P66 R69 R83 R3 Y4 R5 P6 R12 R26 K27 L28 P29 R32 R46
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6j99, PDBe:6j99, PDBj:6j99
PDBsum6j99
PubMed30770869
UniProtA0A310TTQ1

[Back to BioLiP]