Structure of PDB 6j4c Chain A |
>6j4cA (length=123) Species: 1462558 (Streptomyces sp. B9173) [Search protein sequence] |
PADPEIVEGLPIPLAVAGHHQPAPFYLTADMFGGLPVQLAGGELSTLVGK PVAAPHTHPVDELYLLVSPNKGGARIEVQLDGRRHELLSPAVMRIPAGSE HCFLTLEAEVGSYCFGILLGDRL |
|
PDB | 6j4c Structural basis of the mechanism of beta-methyl epimerization by enzyme MarH. |
Chain | A |
Resolution | 1.58 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H62 H64 E68 H107 |
H56 H58 E62 H101 |
|
|
|