Structure of PDB 6j44 Chain A |
>6j44A (length=126) Species: 9606 (Homo sapiens) [Search protein sequence] |
MEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQE YLLKDCDLEKREPPLKFIVKKDMKLYLKLQIVKRSLEVWGSQEALEEAKE VRQENREKMKQKKFDKKVKELRRAVR |
|
PDB | 6j44 Structural characterization of the redefined DNA-binding domain of human XPA. |
Chain | A |
Resolution | 2.06 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C105 C108 C126 C129 |
C8 C11 C29 C32 |
|
|
|
|