Structure of PDB 6j3y Chain A

Receptor sequence

>6j3yA (length=334)

VSLWERFCAWITSTENRLYIGWFGCLMFPTLLTATSCFIIAFIAAPPVDI
DGIREPVAGSLLYGNNIISGAVVPSSNAIGMHFYPIWEAASIDEWLYNGG
PYQLIVLHFLLGVSAYMGREWELSYRLGMRPWIFVAFSAPVAAASAVFLV
YPIGQGSFSDGMPLGISGTFNFMLVFQAEHNILMHPFHMAGVAGVFGGSL
FSAMHGSLVTSSLIRETTENESTNYGYKFGQEEETYNIVAAHGYFGRLIF
QYASFNNSRALHFFLALWPVVGIWITSMGISTMAFNLNGFNFNQSVVDSQ
GRVINTWADILNRANLGIEVMHERNAHNFPLDLA

3D structure

• PDB: 6j3y Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.
• Chain: A
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	V307 D308 S309	V297 D298 S299
BS02	FE2	A	H215 H272	H205 H262
BS03	CLA	A	F147 P150 A153 M183 F186 I192 L193 H198 G201 V202 F206 T286 I290	F137 P140 A143 M173 F176 I182 L183 H188 G191 V192 F196 T276 I280
BS04	PHO	A	L41 T45 F119 A146 F147	L31 T35 F109 A136 F137
BS05	CLA	A	T40 T43 F93 P95 I96 W97 H118 L121	T30 T33 F83 P85 I86 W87 H108 L111
BS06	BCT	A	H215 Y246 H272	H205 Y236 H262
BS07	OEX	A	S169 D170 E189 H332 E333 H337 D342 A344	S159 D160 E179 H322 E323 H327 D332 A334
BS08	CLA	A	F48 F158 M172 I176 T179 F180 M183	F38 F148 M162 I166 T169 F170 M173
BS09	CLA	A	V202 F206 G207	V192 F196 G197
BS10	PHO	A	L210 M214	L200 M204

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 14:00:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6j3y', asym_id = 'A', title = 'Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6j3y', asym_id='A', title='Structural basis for energy harvesting and dissipation in a diatom PSII-FCPII supercomplex.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0009055,0009772,0019684,0045156', uniprot = '', pdbid = '6j3y', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009055,0009772,0019684,0045156', uniprot='', pdbid='6j3y', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>