Structure of PDB 6iq6 Chain A

Receptor sequence
>6iq6A (length=333) Species: 9606 (Homo sapiens) [Search protein sequence]
KVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDST
HGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVF
TTMEKAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASC
TTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGA
LQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKP
AKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIA
LNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
3D structure
PDB6iq6 Structural Study of Monomethyl Fumarate-Bound Human GAPDH.
ChainA
Resolution2.29 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C152 H179
Catalytic site (residue number reindexed from 1) C150 H177
Enzyme Commision number 1.2.1.12: glyceraldehyde-3-phosphate dehydrogenase (phosphorylating).
2.6.99.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 AW9 A C152 H179 N316 Y320 C150 H177 N314 Y318
Gene Ontology
Molecular Function
GO:0004365 glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0016491 oxidoreductase activity
GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016740 transferase activity
GO:0019828 aspartic-type endopeptidase inhibitor activity
GO:0035605 peptidyl-cysteine S-nitrosylase activity
GO:0042802 identical protein binding
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0097718 disordered domain specific binding
Biological Process
GO:0000226 microtubule cytoskeleton organization
GO:0001819 positive regulation of cytokine production
GO:0006006 glucose metabolic process
GO:0006096 glycolytic process
GO:0006417 regulation of translation
GO:0006915 apoptotic process
GO:0010951 negative regulation of endopeptidase activity
GO:0016241 regulation of macroautophagy
GO:0017148 negative regulation of translation
GO:0031640 killing of cells of another organism
GO:0032481 positive regulation of type I interferon production
GO:0035606 peptidyl-cysteine S-trans-nitrosylation
GO:0043123 positive regulation of canonical NF-kappaB signal transduction
GO:0045087 innate immune response
GO:0050821 protein stabilization
GO:0050832 defense response to fungus
GO:0051402 neuron apoptotic process
GO:0051873 killing by host of symbiont cells
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0071346 cellular response to type II interferon
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005811 lipid droplet
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0031965 nuclear membrane
GO:0031982 vesicle
GO:0043231 intracellular membrane-bounded organelle
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0097452 GAIT complex
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6iq6, PDBe:6iq6, PDBj:6iq6
PDBsum6iq6
PubMed31387164
UniProtP04406|G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase (Gene Name=GAPDH)

[Back to BioLiP]