Structure of PDB 6imk Chain A

Receptor sequence

>6imkA (length=409) Species: 10497 (African swine fever virus)

SMLNQFPGQYSNNIFCFPPIESETKSGKKASWIICVQVVQHNTIIPITDE
MFSTDVKDAVAEIFTKFFVEEGAVRISKMTRVTEGKNLGKKNATTVVHQA
FKDALSKYNRHARQKRGNRGMIPPMLVKYFNIIPKTFFEEETDPIVQRKR
NGVRAVACQQGDGCILLYSRTEKEFLGLDNIKKELKQLYLFIDVRVYLDG
ELYLHRKPLQWIAGQANAKTDSSELHFYVFDCFWSDQLQMPSNKRQQLLT
NIFKQKEDLTFIHQVENFSVKNVDEALRLKAQFIKEGYEGAIVRNANGPY
EPGYNNYHSAHLAKLKPLLDAEFILVDYTQGKKGKDLGAILWVCELPNKK
RFVVTPKHLTYADRYALFQKLTPALFKKHLYGKELTVEYAELSPKTGIPL
QARAVGFRE

3D structure

• PDB: 6imk Structure of the error-prone DNA ligase of African swine fever virus identifies critical active site residues.
• Chain: A
• Resolution: 2.502 Å

Enzymatic activity

• Enzyme Commision number: 6.5.1.1: DNA ligase (ATP).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	T23 W31 T64 F66 K89 K90 N91 K114 K130 Q212 G216 A220 K221 N307 Y309 K334 K335 G336 K337 D338 F354 V355 S395 T398 L402	T24 W32 T65 F67 K90 K91 N92 K115 K128 Q210 G214 A218 K219 N305 Y307 K332 K333 G334 K335 D336 F352 V353 S393 T396 L400
BS02	dna	A	K85 N86 Q98 S105 R109 R112 R156 S171 T173 K175 L211 N219	K86 N87 Q99 S106 R110 R113 R154 S169 T171 K173 L209 N217
BS03	dna	A	S25 K27 G71 A72 R74 K359 H360 T362 Y363 R405	S26 K28 G72 A73 R75 K357 H358 T360 Y361 R403

Gene Ontology

Molecular Function

• GO:0003909 DNA ligase activity
• GO:0003910 DNA ligase (ATP) activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006260 DNA replication
• GO:0006281 DNA repair
• GO:0006310 DNA recombination
• GO:0051301 cell division

Cellular Component

• GO:0044423 virion component

External links

• PDB: RCSB:6imk, PDBe:6imk, PDBj:6imk
• PDBsum: 6imk
• PubMed: 30674878
• UniProt: P35970|DNLI_ASFB7 DNA ligase (Gene Name=LIG)