Structure of PDB 6ii1 Chain A

Receptor sequence

>6ii1A (length=137) Species: 9913 (Bos taurus)

LSAADKGNVKAAWGKVGGHAAEYGAEALERMFLSFPTTKTYFPHFDLSHG
SAQVKGHGAKVAAALTKAVEHLDDLPGALSELSDLHAHKLRVDPVNFKLL
SHSLLVTLASHLPSDFTPAVHASLDKFLANVSTVLTS

3D structure

• PDB: 6ii1 Quaternary Structure Analysis of a Hemoglobin Core in Hemoglobin-Albumin Cluster.
• Chain: A
• Resolution: 1.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	Y42 F43 H45 H58 K61 L83 H87 L91 V93 N97 F98 L101 L136	Y41 F42 H44 H57 K60 L82 H86 L90 V92 N96 F97 L100 L135

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex

External links

• PDB: RCSB:6ii1, PDBe:6ii1, PDBj:6ii1
• PDBsum: 6ii1
• PubMed: 30444368
• UniProt: P01966|HBA_BOVIN Hemoglobin subunit alpha (Gene Name=HBA)