Structure of PDB 6ifh Chain A |
>6ifhA (length=119) Species: 1231057 (Paenisporosarcina sp. TG-14) [Search protein sequence] |
MKQLLIVDDQQGIRLLLNEVFKREGYTTFLAANGIEALDIAERVKPDGVL LDMKIPGMDGIEILKRIKTRTPDVPVLMMTAYGELDLIKEAMDLGASHYF TKPFDIYELRDAVNEMLRD |
|
PDB | 6ifh Crystal structure of unphosphorylated Spo0F from Paenisporosarcina sp. TG-14, a psychrophilic bacterium isolated from an Antarctic glacier |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
D8 D9 D52 K54 |
D8 D9 D52 K54 |
|
|
|
|