Structure of PDB 6i6h Chain A

Receptor sequence
>6i6hA (length=207) Species: 9031 (Gallus gallus) [Search protein sequence]
MNIFRLTGDLSHLAAIIILLLKIWKSRSCAGISGKSQLLFALVFTTRYLD
LFTSFISLYNTSMKLIYIACSYATVYLIYMKFKATYDGNHDTFRVEFLIV
PVGGLSFLVNHDFSPLEILWTFSIYLESVAILPQLFMISKTGEAETITTH
YLFFLGLYRALYLVNWIWRYYFEGFFDLIAVVAGVVQTVLYCDFFYLYVT
KVLKGKK
3D structure
PDB6i6h Structural basis for pH-dependent retrieval of ER proteins from the Golgi by the KDEL receptor.
ChainA
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A R5 D9 R47 Y48 S54 I56 E117 W120 Y162 N165 W166 R169 R5 D9 R47 Y48 S54 I56 E117 W120 Y162 N165 W166 R169
Gene Ontology
Molecular Function
GO:0005046 KDEL sequence binding
GO:0046923 ER retention sequence binding
Biological Process
GO:0006621 protein retention in ER lumen
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0035437 maintenance of protein localization in endoplasmic reticulum
Cellular Component
GO:0000139 Golgi membrane
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005801 cis-Golgi network
GO:0016020 membrane
GO:0030663 COPI-coated vesicle membrane
GO:0031410 cytoplasmic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6i6h, PDBe:6i6h, PDBj:6i6h
PDBsum6i6h
PubMed30846601
UniProtQ5ZKX9|ERD22_CHICK ER lumen protein-retaining receptor 2 (Gene Name=KDELR2)

[Back to BioLiP]