Structure of PDB 6i4f Chain A

Receptor sequence

>6i4fA (length=350) Species: 36329 (Plasmodium falciparum 3D7)

VQALVVDNGSGNVKAGVAGDDAPRSVFPSIVGRPKDAFVGDEAQTKRGIL
TLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGN
RERMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPI
YEGYALPHAIMRLDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEK
LCYIALNFDEEMKTSEQSSDIEKSYELPDGNIITVGNERFRCPEALFQPS
FLGKEWAGIHTTTFNSIKKCDVDIRKDLYGNIVLSGGTTMYEGIGERLTR
DITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWITKEEYDES

3D structure

• PDB: 6i4f Atomic view into Plasmodium actin polymerization, ATP hydrolysis, and fragmentation.
• Chain: A
• Resolution: 1.5 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	A	G14 S15 G16 K19 G157 D158 V160 R211 K214 E215 G303 M306 Y307 K337	G9 S10 G11 K14 G141 D142 V144 R195 K198 E199 G287 M290 Y291 K321
BS02	ADP	A	G14 S15 G16 N17 K19 G157 D158 G183 R211 K214 E215 G302 G303 T304 M306 Y307 K337	G9 S10 G11 N12 K14 G141 D142 G167 R195 K198 E199 G286 G287 T288 M290 Y291 K321
BS03	K	A	D155 S156 G157 V160 S161	D139 S140 G141 V144 S145

Gene Ontology

Molecular Function

• GO:0005200 structural constituent of cytoskeleton
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity

Biological Process

• GO:0007010 cytoskeleton organization
• GO:0009665 plastid inheritance
• GO:0020014 schizogony
• GO:0070360 symbiont-mediated actin polymerization-dependent cell-to-cell migration in host
• GO:0085017 entry into host cell by a symbiont-containing vacuole

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005884 actin filament
• GO:0015629 actin cytoskeleton

External links

• PDB: RCSB:6i4f, PDBe:6i4f, PDBj:6i4f
• PDBsum: 6i4f
• PubMed: 31199804
• UniProt: Q8I4X0|ACT1_PLAF7 Actin-1 (Gene Name=ACT1)