Structure of PDB 6i24 Chain A

Receptor sequence
>6i24A (length=135) Species: 2986 (Ochromonas danica) [Search protein sequence]
GAMDYSLVKALQTAQQNFVISDPSIPDNPIVYASQGFLTLTGYALSEVLG
RNCRFLQGPETDPKAVEKVRKGLERGEDTTVVLLNYRKDGSTFWNQLFIA
ALRDGEGNVVNYLGVQCKVSEDYAKAFLKNEENEK
3D structure
PDB6i24 A Noncanonical Chromophore Reveals Structural Rearrangements of the Light-Oxygen-Voltage Domain upon Photoactivation.
ChainA
Resolution1.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG A S223 L226 S46 L49
BS02 5DD A C230 R231 L233 Q234 V243 V246 N262 L274 Y289 G291 Q293 C53 R54 L56 Q57 V66 V69 N85 L97 Y112 G114 Q116
BS03 9O9 A V196 N229 C230 R231 Q234 R247 L250 N262 L274 I276 Y289 G291 Q293 V19 N52 C53 R54 Q57 R70 L73 N85 L97 I99 Y112 G114 Q116
External links