Structure of PDB 6i0a Chain A |
>6i0aA (length=77) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
GLYLQVGAFANPDAAELLKAKLSGVTAAPVFISSVVRNQQILHRVRLGPI GSADEVSRTQDSIRVANLGQPTLVRPD |
|
PDB | 6i0a Structural basis of denuded glycan recognition by SPOR domains in bacterial cell division. |
Chain | A |
Resolution | 1.3 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
AMU |
A |
A273 F274 A275 N276 |
A8 F9 A10 N11 |
|
|
|
|