Structure of PDB 6hxu Chain A

Receptor sequence

>6hxuA (length=182) Species: 9606 (Homo sapiens) [Search protein sequence]

AAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGK
QVELALWDTAGLEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVP
EVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRI
QAYDYLECSAKTKEGVREVFETATRAALQKRY

3D structure

PDB

6hxu A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.

Chain

Resolution

1.19 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	A15 G17 K18 T19 C20 F30 Y34 P36 T37 G62 K118 D120 L121 S160 A161 K162	A14 G16 K17 T18 C19 F29 Y33 P35 T36 G61 K117 D119 L120 S159 A160 K161
BS02	MG	A	T19 T37	T18 T36

Gene Ontology

	Molecular Function
GO:0003924	GTPase activity
GO:0005515	protein binding
GO:0005525	GTP binding
GO:0019003	GDP binding

	Biological Process
GO:0000281	mitotic cytokinesis
GO:0001525	angiogenesis
GO:0006886	intracellular protein transport
GO:0006915	apoptotic process
GO:0007015	actin filament organization
GO:0007155	cell adhesion
GO:0007165	signal transduction
GO:0007264	small GTPase-mediated signal transduction
GO:0007266	Rho protein signal transduction
GO:0008333	endosome to lysosome transport
GO:0010595	positive regulation of endothelial cell migration
GO:0015031	protein transport
GO:0030154	cell differentiation
GO:0030334	regulation of cell migration
GO:0030336	negative regulation of cell migration
GO:0043065	positive regulation of apoptotic process
GO:0045766	positive regulation of angiogenesis
GO:0045786	negative regulation of cell cycle
GO:0061154	endothelial tube morphogenesis
GO:0070301	cellular response to hydrogen peroxide
GO:0071479	cellular response to ionizing radiation
GO:0099159	regulation of modification of postsynaptic structure

	Cellular Component
GO:0005634	nucleus
GO:0005768	endosome
GO:0005769	early endosome
GO:0005770	late endosome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0005925	focal adhesion
GO:0010008	endosome membrane
GO:0016020	membrane
GO:0031902	late endosome membrane
GO:0032154	cleavage furrow
GO:0070062	extracellular exosome
GO:0098685	Schaffer collateral - CA1 synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6hxu, PDBe:6hxu, PDBj:6hxu
PDBsum	6hxu
PubMed	31522999
UniProt	P62745\|RHOB_HUMAN Rho-related GTP-binding protein RhoB (Gene Name=RHOB)

[Back to BioLiP]