Structure of PDB 6hv2 Chain A

Receptor sequence

>6hv2A (length=166) Species: 9606 (Homo sapiens)

EYNVRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT
RLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDD
ETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFML
PDDDVQGIQSLYGPGD

3D structure

• PDB: 6hv2 Drug Design Inspired by Nature: Crystallographic Detection of an Auto-Tailored Protease Inhibitor Template.
• Chain: A
• Resolution: 1.709 Å

Enzymatic activity

• Enzyme Commision number: 3.4.24.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	S182 G183 L184 L185 A186 Y214 H222 E223 H226 H232 P242 I243 Y244	S78 G79 L80 L81 A82 Y110 H118 E119 H122 H128 P138 I139 Y140
BS02	ZN	A	H222 H226 H232	H118 H122 H128
BS03	ZN	A	H172 D174 H187 H200	H68 D70 H83 H96
BS04	CA	A	D179 G180 S182 L184 D202 E205	D75 G76 S78 L80 D98 E101
BS05	CA	A	D162 N194 G196 D198	D58 N90 G92 D94
BS06	CA	A	D128 D203 E205	D24 D99 E101

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:6hv2, PDBe:6hv2, PDBj:6hv2
• PDBsum: 6hv2
• PubMed: 30615822
• UniProt: P45452|MMP13_HUMAN Collagenase 3 (Gene Name=MMP13)