Structure of PDB 6hu7 Chain A |
>6hu7A (length=147) Species: 10407 (Hepatitis B virus) [Search protein sequence] |
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKLRQL LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETT |
|
PDB | 6hu7 Structure of Mutant Hepatitis B Core Protein Capsids with Premature Secretion Phenotype. |
Chain | A |
Resolution | 2.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
E40 S44 E46 C48 |
E40 S44 E46 C48 |
|
|
|
|