Structure of PDB 6hsa Chain A

Receptor sequence

>6hsaA (length=145) Species: 511680 (Eshraghiella crossota DSM 2876)

GSHMKILVINGPNLNFLGIREKNIYGNENYEYLVNMINEYCKSKNIEVEC
YQSNHEGAIIDKIQEAYFNGTDGIVINPGAYTHYSYAIRDALASVSHIKK
IEVHISNVNEREEFRHISVTEPVCNGQIVGQGLKGYIMAIDMLNS

3D structure

• PDB: 6hsa Unraveling the kinetic diversity of microbial 3-dehydroquinate dehydratases of shikimate pathway.
• Chain: A
• Resolution: 0.92 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P9 N10 R17 Y22 N74 A77 E99 H101 R108
• Catalytic site (residue number reindexed from 1): P12 N13 R20 Y25 N77 A80 E102 H104 R111
• Enzyme Commision number: 4.2.1.10: 3-dehydroquinate dehydratase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SER	A	N106 Q124	N109 Q127

Gene Ontology

Molecular Function

• GO:0003855 3-dehydroquinate dehydratase activity
• GO:0016829 lyase activity

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009073 aromatic amino acid family biosynthetic process
• GO:0009423 chorismate biosynthetic process
• GO:0019631 quinate catabolic process

External links

• PDB: RCSB:6hsa, PDBe:6hsa, PDBj:6hsa
• PDBsum: 6hsa
• UniProt: D4S0D1