Structure of PDB 6hqp Chain A

Receptor sequence

>6hqpA (length=402) Species: 385957 (Amycolatopsis sp. ATCC 39116)

RPDLAWLDEVTMTQLERNPYEVYERLRAEAPLAFVPVLGSYVASTAEVCR
EVATSPDFEAVITPAGGRTFGHPAIIGVNGDIHADLRSMVEPALQPAEVD
RWIDDLVRPIARRYLERFENDGHAELVAQYCEPVSVRSLGDLLGLQEVDS
DKLREWFAKLNRSVTNAAVDENGEFANPEGFAEGDQAKAEIRAVVDPLID
KWIEHPDDSAISHWLHDGMPPGQTRDREYIYPTIYVYLLGAMQEPGHGMA
STLVGLFSRPEQLEEVVDDPTLIPRAIAEGLRWTSPIWSATARISTKPVT
IAGVDLPAGTPVMLSYGSANHDTGKYEAPSQYDLHRPPLPHLAFGAGNHA
CAGIYFANHVMRIALEELFEAIPNLERDTREGVEFWGWGFRGPTSLHVTW
EV

3D structure

• PDB: 6hqp Enabling microbial syringol conversion through structure-guided protein engineering.
• Chain: A
• Resolution: 1.62 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R167 Q248 E249 C356 A357 G358
• Catalytic site (residue number reindexed from 1): R162 Q243 E244 C351 A352 G353
• Enzyme Commision number: 1.14.14.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	I81 H88 R92 Y242 A246 E249 P250 I292 T296 R298 Y321 A348 F349 G350 A351 H354 C356 A362 M366	I76 H83 R87 Y237 A241 E244 P245 I287 T291 R293 Y316 A343 F344 G345 A346 H349 C351 A357 M361
BS02	JZ3	A	V241 L244 G245 A246 I292 T296	V236 L239 G240 A241 I287 T291

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009056 catabolic process

External links

• PDB: RCSB:6hqp, PDBe:6hqp, PDBj:6hqp
• PDBsum: 6hqp
• PubMed: 31235604
• UniProt: P0DPQ7|GCOA_AMYS7 Aromatic O-demethylase, cytochrome P450 subunit (Gene Name=gcoA)