Structure of PDB 6hoz Chain A

Receptor sequence

>6hozA (length=327) Species: 7897 (Latimeria chalumnae)

MVSLAQVRGALCGALLGDCMGAEFEGSDAVELPDVLEFVRLLEKEKKAGT
LFYTDDTAMTRAVIQSLIAKPDFDEVDMAKRFAEEYKKEPTRGYGAGVVQ
VFKKLLSPKYSDVFQPAREQFDGKGSYGNGGAMRVASIALAYPNIQDVIK
FARRSAQLTHASPLGYNGAILQALAVHFALQGELKRDTFLEQLIGEMERI
EGLPFCSRLKKIKEFLASSNVPKADIVDELGHGIAALESVPTAIYSFLHC
MESDPDIPDLYNNLQRTIIYSISLGGDTDTIATMAGAIAGAYYGMDQVTP
SWKRSCEAIVETEESAVKLYELYCKQL

3D structure

• PDB: 6hoz (ADP-ribosyl)hydrolases: Structural Basis for Differential Substrate Recognition and Inhibition.
• Chain: A
• Resolution: 1.77 Å

Enzymatic activity

• Enzyme Commision number: 3.2.1.143: poly(ADP-ribose) glycohydrolase.
  3.2.2.-
  3.5.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	A	T62 D63 D64 D305	T54 D55 D56 D279
BS02	MG	A	E33 D303 D305 T306	E25 D277 D279 T280
BS03	R5I	A	E33 D63 D64 G101 G103 G105 V106 F129 S134 Y135 G136 N137 G138 H168 I260 D303 D305 T306	E25 D55 D56 G93 G95 G97 V98 F121 S126 Y127 G128 N129 G130 H160 I234 D277 D279 T280
BS04	R7I	A	E33 D63 D64 G103 G105 F129 S134 Y135 G136 N137 G138 H168 I260 D303 D305 T306	E25 D55 D56 G95 G97 F121 S126 Y127 G128 N129 G130 H160 I234 D277 D279 T280

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004649 poly(ADP-ribose) glycohydrolase activity
• GO:0016787 hydrolase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006281 DNA repair
• GO:0060546 negative regulation of necroptotic process
• GO:0140290 peptidyl-serine ADP-deribosylation

Cellular Component

• GO:0005634 nucleus
• GO:0005694 chromosome
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix

External links

• PDB: RCSB:6hoz, PDBe:6hoz, PDBj:6hoz
• PDBsum: 6hoz
• PubMed: 30472116
• UniProt: H3BCW1|ADPRS_LATCH ADP-ribosylhydrolase ARH3 (Gene Name=adprs)