Structure of PDB 6hmy Chain A

Receptor sequence

>6hmyA (length=103) Species: 666 (Vibrio cholerae)

TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQV
EVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAIS
MAN

3D structure

• PDB: 6hmy Crystal structures of cholera toxin in complex with fucosylated receptors point to importance of secondary binding site.
• Chain: A
• Resolution: 1.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GAL	A	E51 W88 K91	E51 W88 K91
BS02	SIA	A	E11 Y12 H13	E11 Y12 H13	PDBbind-CN: -logKd/Ki=7.24,Kd=57.7nM

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005534 galactose binding
• GO:0046812 host cell surface binding
• GO:0090729 toxin activity

Biological Process

• GO:0035821 modulation of process of another organism
• GO:0042531 positive regulation of tyrosine phosphorylation of STAT protein

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0020002 host cell plasma membrane
• GO:0042597 periplasmic space
• GO:1902494 catalytic complex

External links

• PDB: RCSB:6hmy, PDBe:6hmy, PDBj:6hmy
• PDBsum: 6hmy
• PubMed: 31439922
• UniProt: P01556|CHTB_VIBCH Cholera enterotoxin subunit B (Gene Name=ctxB)