Structure of PDB 6hlz Chain A

Receptor sequence

>6hlzA (length=316) Species: 1435057 (Agrobacterium tumefaciens LBA4213 (Ach5))

HMMADLVISSYGGSFQDAQTKAYFDPYAKASGVKVTGTTGTGYAKVKAMV
ESGNVTWDVISAESPAFASEVKDGLLEPIDYSVVKADNVPENFRTKYGVG
YMVFGTNLAWNKDKFPNGVTPAQFFDPNVKGRRVLPSDATYSLEFALMGD
GVKPADLYPLDVKRALKVIDRVKDQVIGYKGASDIQALMQQGEADIVYAG
TGRIKNAIKAGANWSYSWEGALADTEYWAVPKGAPHAAEAMKFINFAVQA
EPQAELTRVIAYGPTNVDALRLLDPAVAKDLPSYPANAKLGAVLNSKWWN
DNYDAVKAEWTTYIMQ

3D structure

• PDB: 6hlz Structural basis for two efficient modes of agropinic acid opine import into the bacterial pathogenAgrobacterium tumefaciens.
• Chain: A
• Resolution: 1.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	G9Z	A	Y37 F41 E89 M128 F130 S163 A208 R229 E252 Y288	Y11 F15 E63 M102 F104 S137 A182 R203 E226 Y262	PDBbind-CN: -logKd/Ki=7.33,Kd=47nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 13:11:06 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6hlz', asym_id = 'A', title = 'Structural basis for two efficient modes of agro... the bacterial pathogenAgrobacterium tumefaciens.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6hlz', asym_id='A', title='Structural basis for two efficient modes of agro... the bacterial pathogenAgrobacterium tumefaciens.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0015846,0019808,0042597', uniprot = '', pdbid = '6hlz', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015846,0019808,0042597', uniprot='', pdbid='6hlz', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>