Structure of PDB 6hi8 Chain A |
>6hi8A (length=130) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYVTVIKQP MDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRA CALRDTAYAIIKEELDEDFEQLCEEIQESR |
|
PDB | 6hi8 Hitting a Moving Target: Simulation and Crystallography Study of ATAD2 Bromodomain Blockers. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
G6W |
A |
V1008 V1013 Y1063 N1064 |
V30 V35 Y85 N86 |
BindingDB: IC50=>150000nM |
|
|