Structure of PDB 6hg0 Chain A

Receptor sequence

>6hg0A (length=388) Species: 384509 (Influenza A virus (A/tern/Australia/G70C/1975(H11N9)))

RDFNNLTKGLCTINSWHIYGKDNAVRIGEDSDVLVTREPYVSCDPDECRF
YALSQGTTIRGKHSNGTIHDRSQYRALISWPLSSPPTVYNSRVECIGWSS
TSCHDGKTRMSICISGPNNNASAVIWYNRRPVTEINTWARNILRTQESEC
VCHNGVCPVVFTDGSATGPAETRIYYFKEGKILKWEPLAGTAKHIEECSC
YGERAEITCTCRDNWQGSNRPVIRIDPVAMTHTSQYICSPVLTDNPRPND
PTVGKCNDPYPGNNNNGVKGFSYLDGVNTWLGRTISIASRSGYEMLKVPN
ALTDDKSKPTQGQTIVLNTDWSGYSGSFMDYWAEGECYRACFYVELIRGR
PKEDKVWWTSNSIVSMCSSTEFLGQWDWPDGAKIEYFL

3D structure

• PDB: 6hg0 High Resolution Structures of Viral Neuraminidase with Drugs Bound in the Active Site. (In preparation)
• Chain: A
• Resolution: 1.3 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D152 E279 R294 R372 Y406
• Catalytic site (residue number reindexed from 1): D70 E197 R212 R290 Y324
• Enzyme Commision number: 3.2.1.18: exo-alpha-sialidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D295 G299 D326 N348	D213 G217 D244 N266
BS02	SIA	A	R119 E120 D152 R153 W180 A248 E278 R294 R372 Y406	R37 E38 D70 R71 W98 A166 E196 R212 R290 Y324
BS03	SIA	A	S368 S371 S373 N400 T401 D402 W403 K434	S286 S289 S291 N318 T319 D320 W321 K352

Gene Ontology

Molecular Function

• GO:0004308 exo-alpha-sialidase activity

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0046761 viral budding from plasma membrane

Cellular Component

• GO:0016020 membrane
• GO:0033644 host cell membrane
• GO:0055036 virion membrane

External links

• PDB: RCSB:6hg0, PDBe:6hg0, PDBj:6hg0
• PDBsum: 6hg0
• UniProt: P03472|NRAM_I75A5 Neuraminidase (Gene Name=NA)