Structure of PDB 6ha4 Chain A |
>6ha4A (length=55) Species: 500485 (Penicillium rubens Wisconsin 54-1255) [Search protein sequence] |
AKYTGKCTKSKNECKYKNDAGKDTFIKCPKFDNKKCTKDNNKCTVDTYNN AVDCD |
|
PDB | 6ha4 Calixarene-mediated assembly of a small antifungal protein. |
Chain | A |
Resolution | 1.33 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
T3Y |
A |
K30 F31 D32 |
K30 F31 D32 |
MOAD: Kd=107uM PDBbind-CN: -logKd/Ki=3.97,Kd=107uM |
|
|
|