Structure of PDB 6h9i Chain A

Receptor sequence

>6h9iA (length=250) Species: 76114 (Aromatoleum aromaticum EbN1) [Search protein sequence]

GQQHLLRFALPAGKKLWPNDLREALAKHDLPPLFFSRDPQTGHAITRAMR
NEKRVRGYIEQHGHEPPPPTEEQRANPLAIPGIRIVGSSTWVGILATGER
YKPLLEAATLPAIQIVTQRCGRGVGVELEQHTLSIKGLDDPKRYFVRNLV
MKRGLTKTAENTTQVASRILSALERQAVAYSLDLPPTAQVDIHVESVVRP
RGMRLVTSTGATEQFVGLADVEFYACLDLKGYWFAGNLTSRGYGRIIADH

3D structure

PDB

6h9i Type IV CRISPR RNA processing and effector complex formation in Aromatoleum aromaticum.

Chain

Resolution

2.29 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	W18 R23 H44 A45 I46 T47 R48 A49 R51 N52 R55 A80 S89 S90 F146 R148 N149 K153 L156 K158 R176 R200 P201 R202 G203 M204 L206 T208 S209 T213 Q215 F216 L219 D221 N238 L239 S241 R242 Y244 R246 I248	W17 R22 H43 A44 I45 T46 R47 A48 R50 N51 R54 A79 S88 S89 F145 R147 N148 K152 L155 K157 R175 R199 P200 R201 G202 M203 L205 T207 S208 T212 Q214 F215 L218 D220 N237 L238 S240 R241 Y243 R245 I247
BS02	rna	A	Q3 Q131	Q2 Q130

Gene Ontology

	Molecular Function
GO:0046872	metal ion binding

View graph for
Molecular Function

External links

PDB	RCSB:6h9i, PDBe:6h9i, PDBj:6h9i
PDBsum	6h9i
PubMed	30397343
UniProt	Q5NWP0

[Back to BioLiP]