Structure of PDB 6h9b Chain A

Receptor sequence

>6h9bA (length=431) Species: 9940 (Ovis aries) [Search protein sequence]

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDDSFNTFFSETG
AGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGH
YTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERL
SVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNE
AIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQT
NLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDP
RHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINY
QPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHW
YVGEGMEEGEFSEAREDMAALEKDYEEVGVD

3D structure

PDB

6h9b 1,1-Diheterocyclic Ethylenes Derived from Quinaldine and Carbazole as New Tubulin-Polymerization Inhibitors: Synthesis, Metabolism, and Biological Evaluation.

Chain

Resolution

2.75 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	A	G10 Q11 A12 Q15 A99 N101 S140 G143 G144 T145 G146 V177 T179 E183 N206 Y224 N228	G10 Q11 A12 Q15 A92 N94 S133 G136 G137 T138 G139 V170 T172 E176 N199 Y217 N221
BS02	FWH	A	A180 V181	A173 V174	PDBbind-CN: -logKd/Ki=5.70,IC50=2.0uM

Gene Ontology

	Molecular Function
GO:0005200	structural constituent of cytoskeleton
GO:0005525	GTP binding
GO:0016787	hydrolase activity
GO:0042802	identical protein binding
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding
GO:0046982	protein heterodimerization activity

	Biological Process
GO:0000226	microtubule cytoskeleton organization
GO:0000278	mitotic cell cycle
GO:0001764	neuron migration
GO:0001964	startle response
GO:0006886	intracellular protein transport
GO:0007017	microtubule-based process
GO:0007098	centrosome cycle
GO:0007224	smoothened signaling pathway
GO:0007613	memory
GO:0007626	locomotory behavior
GO:0008344	adult locomotory behavior
GO:0008542	visual learning
GO:0009612	response to mechanical stimulus
GO:0010001	glial cell differentiation
GO:0010467	gene expression
GO:0021542	dentate gyrus development
GO:0021696	cerebellar cortex morphogenesis
GO:0021766	hippocampus development
GO:0021859	pyramidal neuron differentiation
GO:0021987	cerebral cortex development
GO:0022008	neurogenesis
GO:0030182	neuron differentiation
GO:0030317	flagellated sperm motility
GO:0030534	adult behavior
GO:0034612	response to tumor necrosis factor
GO:0035641	locomotory exploration behavior
GO:0046785	microtubule polymerization
GO:0048853	forebrain morphogenesis
GO:0048873	homeostasis of number of cells within a tissue
GO:0050807	regulation of synapse organization
GO:0050808	synapse organization
GO:0051402	neuron apoptotic process
GO:0061744	motor behavior
GO:0071277	cellular response to calcium ion
GO:0072384	organelle transport along microtubule
GO:0140058	neuron projection arborization
GO:1902065	response to L-glutamate

	Cellular Component
GO:0000793	condensed chromosome
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005856	cytoskeleton
GO:0005874	microtubule
GO:0005879	axonemal microtubule
GO:0005881	cytoplasmic microtubule
GO:0005886	plasma membrane
GO:0015630	microtubule cytoskeleton
GO:0031594	neuromuscular junction
GO:0036126	sperm flagellum
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0045202	synapse
GO:0055037	recycling endosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6h9b, PDBe:6h9b, PDBj:6h9b
PDBsum	6h9b
PubMed	30525602
UniProt	D0VWZ0

[Back to BioLiP]