Structure of PDB 6h74 Chain A

Receptor sequence

>6h74A (length=244) Species: 354 (Azotobacter vinelandii) [Search protein sequence]

RPIRLLPWLQVVKIGGRVMDRGADAILPLVEELRKLLPEHRLLILTGAGV
RARHVFSVGLDLGLPVGSLAPLAASEAGQNGHILAAMLASEGVSYVEHPT
VADQLAIHLSATRAVVGSAFPPYHHHEFPGSRIPPHRADTGAFLLADAFG
AAGLTIVENVDGIYTADPNGPDRGQARFLPETSATDLAKSEGPLPVDRAL
LDVMATARHIERVQVVNGLVPGRLTAALRGEHVGTLIRTGVRPA

3D structure

PDB

6h74 The molybdenum storage protein - A bionanolab for creating experimentally alterable polyoxomolybdate clusters.

Chain

Resolution

1.801 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	FUQ	A	H156 H157 H158	H124 H125 H126
BS02	ATP	A	K45 G47 G48 R49 A80 E190 N191 V192 Y196 D199 P200 N201 P225 L226 P227	K13 G15 G16 R17 A48 E158 N159 V160 Y164 D167 P168 N169 P193 L194 P195
BS03	MG	A	E190 P227	E158 P195
BS04	GWN	A	P103 A106 S107 G110 Q111 H114 Y127 E129 H130 P131 S150 H156	P71 A74 S75 G78 Q79 H82 Y95 E97 H98 P99 S118 H124

Gene Ontology

	Molecular Function
GO:0030151	molybdenum ion binding
GO:0045735	nutrient reservoir activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6h74, PDBe:6h74, PDBj:6h74
PDBsum	6h74
PubMed	30278367
UniProt	P84308\|MOSA_AZOVD Molybdenum storage protein subunit alpha (Gene Name=mosA)

[Back to BioLiP]