Structure of PDB 6h6d Chain A

Receptor sequence
>6h6dA (length=272) Species: 10090 (Mus musculus) [Search protein sequence]
GPHSMRYFETAVSRPGLEEPRYISVGYVDNKEFVRFDSDAENPRYEPRAP
WMEQEGPEYWERETQKAKGQEQWFRVSLRNLLGYYNQSAGGSHTLQQMSG
CDLGSDWRLLRGYLQFAYEGRDYIALNEDLKTWTAADMAAQITRRKWEQS
GAAEHYKAYLEGECVEWLHRYLKNGLRTDSPKAHVTHHPRSKGEVTLRCW
ALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKE
QNYTCRVYHEGLPEPLTLRWEP
3D structure
PDB6h6d Crystal structures of H-2Db and H-2Dbm13 with cancer-associated Ad 10 peptide reveal that subtle changes in the peptide environment impact thermostability and alloreactivity
ChainA
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A Y7 E9 E63 K66 Q70 W73 V76 S77 N80 L81 Y84 Q97 T143 K146 W147 S150 H155 Y156 Y159 E163 W167 Y171 Y7 E9 E63 K66 Q70 W73 V76 S77 N80 L81 Y84 Q97 T143 K146 W147 S150 H155 Y156 Y159 E163 W167 Y171
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0001913 T cell mediated cytotoxicity
GO:0001916 positive regulation of T cell mediated cytotoxicity
GO:0002474 antigen processing and presentation of peptide antigen via MHC class I
GO:0002485 antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
GO:0006955 immune response
GO:0010977 negative regulation of neuron projection development
GO:0019882 antigen processing and presentation
Cellular Component
GO:0005886 plasma membrane
GO:0009897 external side of plasma membrane
GO:0016020 membrane
GO:0030670 phagocytic vesicle membrane
GO:0042612 MHC class I protein complex
GO:0098553 lumenal side of endoplasmic reticulum membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h6d, PDBe:6h6d, PDBj:6h6d
PDBsum6h6d
PubMed
UniProtP01899|HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain (Gene Name=H2-D1)

[Back to BioLiP]