Structure of PDB 6h65 Chain A

Receptor sequence

>6h65A (length=305) Species: 502025 (Haliangium ochraceum DSM 14365)

PPRYGWMNGQCIPWDQCSLHVSTQAAFFGASLFEGVRAYWNAEREQLYVF
RLDEHLRRLEQSAKMLRMKLSMPIADIRQGVLELLRANEFRSDVHLYVAS
YFGINHDPDPLFPTDDTGVYVTGTAVSRLPLVHTGISACMSSWRRISDDS
VPPRIKIGANYQNSRLAQTEARVNGYHTSVLLNSRGKVSETPGACLLMVR
DGRVISPPVTADILESVTRKTLMSLSEAELDSPVIERDMDRTELYIAEEV
FLCGTIAEILPVTTIDRIQVGDGEVGPVTRRLQELYFGVTSGQLEAYKSW
LLPVY

3D structure

• PDB: 6h65 Crystal structure of the branched-chain-amino-acid aminotransferase from Haliangium ochraceum
• Chain: A
• Resolution: 2.35 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): F44 K167 E201 L225
• Catalytic site (residue number reindexed from 1): F33 K156 E190 L214
• Enzyme Commision number: 2.6.1.42: branched-chain-amino-acid transaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PLP	A	R69 K167 Y172 E201 A205 L225 S227 V228 T229 G265 T266	R58 K156 Y161 E190 A194 L214 S216 V217 T218 G254 T255

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004084 branched-chain-amino-acid transaminase activity
• GO:0008483 transaminase activity
• GO:0052654 L-leucine-2-oxoglutarate transaminase activity
• GO:0052655 L-valine-2-oxoglutarate transaminase activity
• GO:0052656 L-isoleucine-2-oxoglutarate transaminase activity

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009081 branched-chain amino acid metabolic process
• GO:0009082 branched-chain amino acid biosynthetic process
• GO:0009097 isoleucine biosynthetic process
• GO:0009098 L-leucine biosynthetic process
• GO:0009099 L-valine biosynthetic process
• GO:0019752 carboxylic acid metabolic process
• GO:0046394 carboxylic acid biosynthetic process

External links

• PDB: RCSB:6h65, PDBe:6h65, PDBj:6h65
• PDBsum: 6h65
• UniProt: D0LR31