Structure of PDB 6h61 Chain A

Receptor sequence

>6h61A (length=660) Species: 10090 (Mus musculus)

QLRPYQMEVAQPALDGKNIIICLPTGSGKTRVAVYITKDHLDKKKQASES
GKVIVLVNKVMLAEQLFRKEFNPYLKKWYRIIGLSGDTQLKISFPEVVKS
YDVIISTAQILENSLLNLESGDDDGVQLSDFSLIIIDECHHTNKEAVYNN
IMRRYLKQKLRNNDLKKQNAIPLPQILGLTASPGVGAAKKQSEAEKHILN
ICANLDAFTIKTVKENLGQLKHQIKEPCKKFVIANPFKEKLLEIMASIQT
YCQKSPMSDFGTQHYEQWAIQMEKKAAKDGNRKDRVCAEHLRKYNEALQI
NDTIRMIDAYSHLETFYTDEKEKKFAVLNLDETDEFLMNLFFDNKKMLKK
LAENPKEKLIKLRNTILEQFTRSESSRGIIFTKTRQSTYALSQWIMENAK
VGVKAHHLIGAGHSSEVKPMTQTEQKEVISKFRTGEINLLIATTVAELDI
KECNIVIRYGLVTNEIAMVQARGRARADESTYVLVTSSGVTEREIVNDFR
EKMMYKAINRVQNMKPEEYAHKILELQVQSILEKKMKVKRSIAKQYNDNP
SLITLLCKNCSMLVCSGENIHVIEKMHHVNMTPEFKGLYIVRENKTNGEI
ICKCGQAWGTMMVHKGLDLPCLKIRNFVVNFKNNSPKKQYKKWVELPIRF
PDLDYSEYCL

3D structure

• PDB: 6h61 Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
• Chain: A
• Resolution: 4.02 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.13: RNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	K451 E452 H578 Q581 K764 T767 T769 N812 H927	K144 E145 H264 Q267 K418 T421 T423 N464 H577
BS02	rna	A	N365 K366 G393 Q416 K726 T727 R728 I755 G756 T789 T790 V791 E924 M926	N58 K59 G86 Q109 K383 T384 R385 I409 G410 T443 T444 V445 E574 M576
BS03	ZN	A	C910 C962 C964	C560 C602 C604

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003723 RNA binding
• GO:0003724 RNA helicase activity
• GO:0003725 double-stranded RNA binding
• GO:0003727 single-stranded RNA binding
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0016887 ATP hydrolysis activity
• GO:0019904 protein domain specific binding
• GO:0038187 pattern recognition receptor activity
• GO:0042802 identical protein binding
• GO:0043021 ribonucleoprotein complex binding
• GO:0046872 metal ion binding

Biological Process

• GO:0002376 immune system process
• GO:0009615 response to virus
• GO:0016925 protein sumoylation
• GO:0032727 positive regulation of interferon-alpha production
• GO:0032728 positive regulation of interferon-beta production
• GO:0032755 positive regulation of interleukin-6 production
• GO:0032760 positive regulation of tumor necrosis factor production
• GO:0039530 MDA-5 signaling pathway
• GO:0045071 negative regulation of viral genome replication
• GO:0045087 innate immune response
• GO:0051259 protein complex oligomerization
• GO:0051607 defense response to virus
• GO:0060337 type I interferon-mediated signaling pathway
• GO:0060760 positive regulation of response to cytokine stimulus
• GO:0071360 cellular response to exogenous dsRNA
• GO:0098586 cellular response to virus
• GO:0140374 antiviral innate immune response

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion

External links

• PDB: RCSB:6h61, PDBe:6h61, PDBj:6h61
• PDBsum: 6h61
• PubMed: 30449722
• UniProt: Q8R5F7|IFIH1_MOUSE Interferon-induced helicase C domain-containing protein 1 (Gene Name=Ifih1)