Structure of PDB 6h4l Chain A |
>6h4lA (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] |
TLDHAPRITLRMRSHRVPCGQNTRFILNVQSKPTAEVKWYHNGVELQESS KIHYTNTSGVLTLEILDCHTDDSGTYRAVCTNYKGEASDYATLDVT |
|
PDB | 6h4l Structural diversity in the atomic resolution 3D fingerprint of the titin M-band segment. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.11.1: non-specific serine/threonine protein kinase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
D70 H72 |
D67 H69 |
|
|
|