Structure of PDB 6h1d Chain A

Receptor sequence
>6h1dA (length=207) Species: 9606 (Homo sapiens) [Search protein sequence]
STPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGS
GVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVK
GLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEAAWAGGRNGREVMDRFF
PLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETL
SVLKFTK
3D structure
PDB6h1d KMT9 monomethylates histone H4 lysine 12 and controls proliferation of prostate cancer cells.
ChainA
Resolution1.94 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SAH A Y23 T29 G53 S54 G55 D77 I78 D103 L104 N122 P124 A140 Y17 T23 G47 S48 G49 D71 I72 D97 L98 N116 P118 A134 PDBbind-CN: -logKd/Ki=5.60,Kd=2.5uM
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008276 protein methyltransferase activity
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
GO:0009007 site-specific DNA-methyltransferase (adenine-specific) activity
GO:0030791 arsenite methyltransferase activity
GO:0036009 protein-glutamine N-methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0140984 histone H4K12 methyltransferase activity
GO:1904047 S-adenosyl-L-methionine binding
Biological Process
GO:0006325 chromatin organization
GO:0009404 toxin metabolic process
GO:0018364 peptidyl-glutamine methylation
GO:0018872 arsonoacetate metabolic process
GO:0030307 positive regulation of cell growth
GO:0032259 methylation
GO:0045814 negative regulation of gene expression, epigenetic
GO:0045815 transcription initiation-coupled chromatin remodeling
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol
GO:0032991 protein-containing complex
GO:0035657 eRF1 methyltransferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6h1d, PDBe:6h1d, PDBj:6h1d
PDBsum6h1d
PubMed31061526
UniProtQ9Y5N5|N6MT1_HUMAN Methyltransferase N6AMT1 (Gene Name=N6AMT1)

[Back to BioLiP]