Structure of PDB 6gzd Chain A

Receptor sequence
>6gzdA (length=297) Species: 9606 (Homo sapiens) [Search protein sequence]
AEFIVGGKYKLGRKIGSGSFGDIYLATNITNGEEVAVKLESQKARHPQLH
YESKLYKILQGGVGIPHIRWYGQEKDYNVLVMDLLGPSLEDLFNFCSRRF
TMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKLFLIDF
GLAKKYRDNRTRQHIPYREDKNLTGTARYASINAHLGIEQSRRDDMESLG
YVLMYFNRTSLPWQGLKAATKKQKYEKISEKKMSTPVEVLCKGFPAEFAM
YLNYCRGLRFEEAPDYMYLRQLFRILFRTLNHQYDYTFDWTMLKQKA
3D structure
PDB6gzd Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
ChainA
Resolution2.28 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 TCE A W221 Q222 G223 L224 K232 I236 W213 Q214 G215 L216 K224 I228
BS02 LCI A S25 I31 A44 M90 L93 D99 L143 S17 I23 A36 M82 L85 D91 L135 MOAD: Kd=9.8nM
PDBbind-CN: -logKd/Ki=8.01,Kd=9.8nM
Gene Ontology
Molecular Function
GO:0004672 protein kinase activity
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006468 protein phosphorylation
GO:0007030 Golgi organization
GO:0007165 signal transduction
GO:0007166 cell surface receptor signaling pathway
GO:0016055 Wnt signaling pathway
GO:0016310 phosphorylation
GO:0018105 peptidyl-serine phosphorylation
GO:0019082 viral protein processing
GO:0031670 cellular response to nutrient
GO:0032436 positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0035025 positive regulation of Rho protein signal transduction
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045104 intermediate filament cytoskeleton organization
GO:0051301 cell division
GO:0090090 negative regulation of canonical Wnt signaling pathway
GO:1900226 negative regulation of NLRP3 inflammasome complex assembly
GO:1904263 positive regulation of TORC1 signaling
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005819 spindle
GO:0005829 cytosol
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
GO:0005856 cytoskeleton
GO:0005929 cilium
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0030877 beta-catenin destruction complex
GO:0036064 ciliary basal body
GO:0042995 cell projection
GO:0045095 keratin filament

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gzd, PDBe:6gzd, PDBj:6gzd
PDBsum6gzd
PubMed30146162
UniProtP48729|KC1A_HUMAN Casein kinase I isoform alpha (Gene Name=CSNK1A1)

[Back to BioLiP]