Structure of PDB 6gyi Chain A |
>6gyiA (length=127) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] |
ECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLS TAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSK LKEGEQYMFFCTFPGHSALMKGTLTLK |
|
PDB | 6gyi Azurin and HS-: towards implementation of a sensor for HS-detection. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
A |
H46 C112 H117 |
H45 C111 H116 |
|
|
|
|