Structure of PDB 6gu0 Chain A

Receptor sequence

>6gu0A (length=279) Species: 488477 (Escherichia coli F18+)

FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPE
TITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTD
KPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYA
NNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGT
TADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSL
GLTANYARTGGQVTAGNVQSIIGVTFVYQ

3D structure

• PDB: 6gu0 Binding of the Bacterial Adhesin FimH to Its Natural, Multivalent High-Mannose Type Glycan Targets.
• Chain: A
• Resolution: 2.501 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	V163 R166 D167 V168 T169 V170 T171 L172 D174 Y175 V223 Y256 T264 A265 G266 N267 V268 Q269 S270 I271 I272 G273 V274 F276	V163 R166 D167 V168 T169 V170 T171 L172 D174 Y175 V223 Y256 T264 A265 G266 N267 V268 Q269 S270 I271 I272 G273 V274 F276
BS02	MMA	A	Y48 Y137	Y48 Y137
BS03	MAN	A	F1 I13 N46 D54 Q133 N135 D140	F1 I13 N46 D54 Q133 N135 D140

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

Biological Process

• GO:0007155 cell adhesion
• GO:0043709 cell adhesion involved in single-species biofilm formation

Cellular Component

• GO:0009289 pilus

External links

• PDB: RCSB:6gu0, PDBe:6gu0, PDBj:6gu0
• PDBsum: 6gu0
• PubMed: 30543411
• UniProt: A0A0R4I961