Structure of PDB 6gtv Chain A

Receptor sequence

>6gtvA (length=279) Species: 488477 (Escherichia coli F18+)

FACKTANGTAIPIGGGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPE
TITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTD
KPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYA
NNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGT
TADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSL
GLTANYARTGGQVTAGNVQSIIGVTFVYQ

3D structure

• PDB: 6gtv Binding of the Bacterial Adhesin FimH to Its Natural, Multivalent High-Mannose Type Glycan Targets.
• Chain: A
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	G116 A165 R166 D167 V168 T169 V170 T171 L172 D174 Y175 A218 Y256 T264 A265 G266 V268 Q269 S270 I271 I272 G273 V274 T275 F276	G116 A165 R166 D167 V168 T169 V170 T171 L172 D174 Y175 A218 Y256 T264 A265 G266 V268 Q269 S270 I271 I272 G273 V274 T275 F276
BS02	MAN	A	F1 I13 N46 I52 D54 Q133 N135 D140	F1 I13 N46 I52 D54 Q133 N135 D140

Gene Ontology

Molecular Function

• GO:0046872 metal ion binding

Biological Process

• GO:0007155 cell adhesion
• GO:0043709 cell adhesion involved in single-species biofilm formation

Cellular Component

• GO:0009289 pilus

External links

• PDB: RCSB:6gtv, PDBe:6gtv, PDBj:6gtv
• PDBsum: 6gtv
• PubMed: 30543411
• UniProt: A0A0R4I961