Structure of PDB 6gsv Chain A

Receptor sequence
>6gsvA (length=217) Species: 10117 (Rattus rattus) [Search protein sequence]
PMILGYWNVRGLSHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKF
KLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVE
NQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGD
KVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSS
RYLSTPIFSKLAQWSNK
3D structure
PDB6gsv First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
ChainA
Resolution1.75 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Y6 L12 R17
Catalytic site (residue number reindexed from 1) Y6 L12 R17
Enzyme Commision number 2.5.1.18: glutathione transferase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 GPS A Y6 W7 G11 L12 W45 K49 N58 L59 Q71 S72 R107 I111 S209 Y6 W7 G11 L12 W45 K49 N58 L59 Q71 S72 R107 I111 S209
Gene Ontology
Molecular Function
GO:0004364 glutathione transferase activity
GO:0005496 steroid binding
GO:0016151 nickel cation binding
GO:0016740 transferase activity
GO:0019899 enzyme binding
GO:0019901 protein kinase binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0043295 glutathione binding
Biological Process
GO:0006629 lipid metabolic process
GO:0006693 prostaglandin metabolic process
GO:0006749 glutathione metabolic process
GO:0007608 sensory perception of smell
GO:0009410 response to xenobiotic stimulus
GO:0010038 response to metal ion
GO:0010288 response to lead ion
GO:0018916 nitrobenzene metabolic process
GO:0042178 xenobiotic catabolic process
GO:0043200 response to amino acid
GO:0045471 response to ethanol
GO:0048678 response to axon injury
GO:0051122 hepoxilin biosynthetic process
GO:0070458 cellular detoxification of nitrogen compound
GO:0071466 cellular response to xenobiotic stimulus
GO:1901687 glutathione derivative biosynthetic process
Cellular Component
GO:0005576 extracellular region
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0032991 protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6gsv, PDBe:6gsv, PDBj:6gsv
PDBsum6gsv
PubMed8664265
UniProtP04905|GSTM1_RAT Glutathione S-transferase Mu 1 (Gene Name=Gstm1)

[Back to BioLiP]