Structure of PDB 6gpz Chain A |
>6gpzA (length=63) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence] |
GHMKVKLSAKEILEKEFKTGVRGYKQEDVDEFLDMIIKDYETFHQEIEEL QQENLQLKKQLEE |
|
PDB | 6gpz The cell cycle regulator GpsB functions as cytosolic adaptor for multiple cell wall enzymes. |
Chain | A |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E50 E54 |
E49 E53 |
|
|
|