Structure of PDB 6gon Chain A |
>6gonA (length=114) Species: 8175 (Sparus aurata) [Search protein sequence] |
CPLMVKILDAVKGTPAGSVALKVSQKTADGGWTQIATGVTDATGEIHNLI TEQQFPAGVYRVEFDTKAYWTNQGSTPFHEVAEVVFDAHPEGHRHYTLAL LLSPFSYTTTAVVS |
|
PDB | 6gon Interspecies Variation between Fish and Human Transthyretins in Their Binding of Thyroid-Disrupting Chemicals. |
Chain | A |
Resolution | 1.65 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
8PF |
A |
K15 A108 L110 |
K6 A99 L101 |
MOAD: Kd=2.16uM PDBbind-CN: -logKd/Ki=5.67,Kd=2.16uM |
|
|
|