Structure of PDB 6gmc Chain A

Receptor sequence

>6gmcA (length=360) Species: 9606 (Homo sapiens)

MLPRLICINDYEQHAKSVLPKSIYDYYRSGANDEETLADNIAAFSRWKLY
PRMLRNVAETDLSTSVLGQRVSMPICVGATAMQRMAHVDGELATVRACQS
LGTGMMLSSWATSSIEEVAEAGPEALRWLQLYIYKDREVTKKLVRQAEKM
GYKAIFVTVDTPYLGNRLDDVRNRFKLPPQLRMKNFSTLSFSPEENFGDD
SGLAAYVAKAIDPSISWEDIKWLRRLTSLPIVAKGILRGDDAREAVKHGL
NGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDVLK
ALALGAKAVFVGRPIVWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNV
KVIDKTLVRK

3D structure

• PDB: 6gmc Structure of human hydroxyacid oxidase 1 bound with FMN and glycolate
• Chain: A
• Resolution: 1.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Y132 D160 H260
• Catalytic site (residue number reindexed from 1): Y132 D160 H258
• Enzyme Commision number: 1.1.3.15: (S)-2-hydroxy-acid oxidase.
  1.2.3.5: glyoxylate oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	A	Y26 Y27 A79 T80 A81 S108 Q130 Y132 T158 K236 H260 G261 R263 D291 G292 R295 G314 R315	Y26 Y27 A79 T80 A81 S108 Q130 Y132 T158 K234 H258 G259 R261 D289 G290 R293 G312 R313
BS02	C7C	A	Y26 M82 W110 Y132 R167 F193 L205 Y208 H260 R263	Y26 M82 W110 Y132 R167 F191 L203 Y206 H258 R261

Gene Ontology

Molecular Function

• GO:0003973 (S)-2-hydroxy-acid oxidase activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0047969 glyoxylate oxidase activity

Biological Process

• GO:0001561 fatty acid alpha-oxidation
• GO:0006545 glycine biosynthetic process
• GO:0006979 response to oxidative stress
• GO:0008652 amino acid biosynthetic process
• GO:0046296 glycolate catabolic process

Cellular Component

• GO:0005777 peroxisome
• GO:0005782 peroxisomal matrix
• GO:0005829 cytosol
• GO:0043231 intracellular membrane-bounded organelle

External links

• PDB: RCSB:6gmc, PDBe:6gmc, PDBj:6gmc
• PDBsum: 6gmc
• UniProt: Q9UJM8|HAOX1_HUMAN 2-Hydroxyacid oxidase 1 (Gene Name=HAO1)