Structure of PDB 6ghv Chain A

Receptor sequence

>6ghvA (length=132) Species: 9606 (Homo sapiens) [Search protein sequence]

CHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNF
LQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVG
EEDCAEFSGNGWNDDKCNLAKFWICKKSAASC

3D structure

PDB

6ghv Enhancing Potency and Selectivity of a DC-SIGN Glycomimetic Ligand by Fragment-Based Design: Structural Basis.

Chain

Resolution

2.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EZ8	A	F313 E347 N349 G352 E354 E358 N365 D367 K368	F61 E95 N97 G100 E102 E106 N113 D115 K116	MOAD: Kd=52uM PDBbind-CN: -logKd/Ki=4.28,Kd=52.0uM
BS02	CA	A	E347 N349 E354 N365 D366	E95 N97 E102 N113 D114
BS03	CA	A	D320 E324 N350 E354 D355	D68 E72 N98 E102 D103
BS04	EZ8	A	Q264 G265	Q12 G13	MOAD: Kd=52uM PDBbind-CN: -logKd/Ki=4.28,Kd=52.0uM
BS05	EZ8	A	N272 R309 S310 N311 R312 F374	N20 R57 S58 N59 R60 F122	MOAD: Kd=52uM PDBbind-CN: -logKd/Ki=4.28,Kd=52.0uM

External links

PDB	RCSB:6ghv, PDBe:6ghv, PDBj:6ghv
PDBsum	6ghv
PubMed	31469191
UniProt	Q9NNX6\|CD209_HUMAN CD209 antigen (Gene Name=CD209)